PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G121570_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 371aa    MW: 39928.8 Da    PI: 7.05
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G121570_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.8e-163379148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+ Ed  l + v ++G + W+ Ia+ ++ gR +kqc++rw ++l
  GRMZM2G121570_P01 33 KGPWTEAEDVVLREMVMKHGDRKWAVIAQSLP-GRVGKQCRERWTNHL 79
                       79******************************.************996 PP

2Myb_DNA-binding51.22.9e-1686127245
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          WT+e+d  l++a+k+ G++ W+tIa  ++ gR+++ +k++w+
  GRMZM2G121570_P01  86 SVWTEEDDMALIKAHKRCGNH-WSTIATFLP-GRSENAVKNHWN 127
                        68*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.4642883IPR017930Myb domain
SuperFamilySSF466896.25E-3031126IPR009057Homeodomain-like
SMARTSM007174.3E-153281IPR001005SANT/Myb domain
PfamPF002493.4E-153379IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-263486IPR009057Homeodomain-like
CDDcd001673.79E-143579No hitNo description
SMARTSM007171.8E-1584132IPR001005SANT/Myb domain
PROSITE profilePS5129418.45584134IPR017930Myb domain
PfamPF002492.8E-1486127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-2087131IPR009057Homeodomain-like
CDDcd001671.03E-1288130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MSSALRAAWS GAQQQLPPHA GGGIGGHRAQ HHKGPWTEAE DVVLREMVMK HGDRKWAVIA  60
QSLPGRVGKQ CRERWTNHLR PDLKKSVWTE EDDMALIKAH KRCGNHWSTI ATFLPGRSEN  120
AVKNHWNATK RSLKAKRRLK KKSNAQQVPA GQWSVLEEYI RSLYPDLADG AGADQTPPAA  180
EDSPPSSYNL GSYSYGEVIS SPASAAAPPG SFDQMTAMGL YLGASSSSPA PAELQGGMSS  240
DIVAPFLHLD LNAYYGGAPA ATMRLMAPMG GMAAPVPQMM EHDHYQHQQA SYATANQLLT  300
YPFIDNSVMW QQAPYAAHGS AAYGGGADAA GAGPSNVVAV PADDVDVVQM ASREFLTPSE  360
DEVTLDLARF R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-40331314102MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-40331314102C-Myb DNA-Binding Domain
1msf_C2e-40331314102C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G121570
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G121570_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0359590.0BT035959.1 Zea mays full-length cDNA clone ZM_BFb0089N08 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132209.10.0uncharacterized protein LOC100193638
TrEMBLA0A096RZI00.0A0A096RZI0_MAIZE; Uncharacterized protein
TrEMBLB4FFS10.0B4FFS1_MAIZE; Uncharacterized protein
TrEMBLK4JC540.0K4JC54_MAIZE; MYB-type transcription factor (Fragment)
STRINGGRMZM2G121570_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.17e-41myb domain protein 64